PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT21400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 353aa    MW: 39595.2 Da    PI: 8.1934
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT21400genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM133.12e-41141281117
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvg 101
               lp GfrFhPtdee+++ y  +kv ++ + +  +i++v+++k+ePw+Lp+k+k +ekewyf+s++d+ky+tg r+nrat  gyWkatgkdke+++   +l+g
  EMT21400  14 LPLGFRFHPTDEEIINSYVIPKVLDEAFVT-AAIEDVNLNKYEPWELPEKAKMGEKEWYFYSRKDRKYPTGIRTNRATGVGYWKATGKDKEIFHPPLTLIG 113
               699************************988.78***************99999************************************************ PP

       NAM 102 lkktLvfykgrapkge 117
               +kktL+fykgrap+ +
  EMT21400 114 MKKTLIFYKGRAPT-R 128
               ************98.3 PP

2NAM354.1e-11127154102129
       NAM 102 lkktLvfykgrapkgektdWvmheyrle 129
               ++ktL+fykgrap+gekt+W+mheyrle
  EMT21400 127 TRKTLIFYKGRAPTGEKTNWIMHEYRLE 154
               59************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-435127IPR003441NAC domain
PROSITE profilePS5100551.98714189IPR003441NAC domain
PfamPF023651.1E-2315153IPR003441NAC domain
SuperFamilySSF1019411.57E-13128189IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MTDHLQVQQQ KLELPLGFRF HPTDEEIINS YVIPKVLDEA FVTAAIEDVN LNKYEPWELP  60
EKAKMGEKEW YFYSRKDRKY PTGIRTNRAT GVGYWKATGK DKEIFHPPLT LIGMKKTLIF  120
YKGRAPTRKT LIFYKGRAPT GEKTNWIMHE YRLESNKELT SNPSTATRTV TATKAASKEQ  180
WVVCRIFHKS TGLKKVVMPS YVMPMSTGAE HQQGLTDLDT FPPLMDYDMS SSLANPTLLP  240
AASSYQLHDI GAGSSMIGSM ALPMMNDHYI GNHRQQMISD PTPPLPFYQQ HQQMMMYMGE  300
DQSFMVGAKP GCGPSSMVSQ EDAVTGLSNN YQGNAAATAG GKTSSVNMSM DDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-4541953171NAC domain-containing protein 19
4dul_A3e-4541953171NAC domain-containing protein 19
1ut7_B3e-4541953171NO APICAL MERISTEM PROTEIN
1ut7_A3e-4541953171NO APICAL MERISTEM PROTEIN
1ut4_B3e-4541953171NO APICAL MERISTEM PROTEIN
1ut4_A3e-4541953171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565350.12e-86PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLM8B9B30.0M8B9B3_AEGTA; Protein CUP-SHAPED COTYLEDON 2
STRINGMLOC_56943.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-69NAC domain containing protein 100